PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn039041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 376aa    MW: 41460.2 Da    PI: 7.3282
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn039041genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.32.5e-3980156278
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 C v+gC++dl+++++y+rrh+vCe hsk+pvv+v g+e+rfCqqCsrf +l efDeekrsCr+rL++hn+rrrk+q+
  Achn039041  80 CFVDGCTNDLTDCRDYYRRHRVCERHSKTPVVVVGGKEKRFCQQCSRFESLGEFDEEKRSCRKRLDGHNRRRRKPQP 156
                 9*************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.8E-3175141IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.20577154IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.29E-3779160IPR004333Transcription factor, SBP-box
PfamPF031101.9E-2980153IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MDWDWDLTEL GQEDLVGSSS LEAHKNGGGF SVELKLGGLG DLGDGSVGKL KEPSGSTISS  60
PSSGTSKRSK LISRTQNISC FVDGCTNDLT DCRDYYRRHR VCERHSKTPV VVVGGKEKRF  120
CQQCSRFESL GEFDEEKRSC RKRLDGHNRR RRKPQPEAFY MSSRTYLSNH QGTKLLCFSV  180
PQVYPTSTVG TVPTWPRVAT HHQDLHAPDQ QSTLPHSFAC IYNGGDKQFP FLLPNDPEGS  240
IQAVPEVSIS QRLVNNSASP ETGWGRTKIL SDVLTESVNS KRALSLLSLH PLQTSETSSS  300
HLLQRDVNRL NKPIGTGLHY DGLAQYSHSQ GLEEKPSGLV PQASNSSNLC NQTFQIAPDD  360
LLENGDSEVL PFSWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-24801531184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136153KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010250660.11e-112PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_010250661.11e-112PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_010250662.11e-112PREDICTED: squamosa promoter-binding-like protein 16
TrEMBLA5BTU01e-100A5BTU0_VITVI; Putative uncharacterized protein
STRINGVIT_14s0068g01780.t011e-99(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-42SBP family protein